SCOPe 2.06: Domain d1gh2a_: 1gh2 A:

Lineage for d1gh2a_ (1gh2 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin-like protein, N-terminal domain [64056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64057] (1 PDB entry)

8. Domain d1gh2a_: 1gh2 A: [60515]

Details for d1gh2a_

PDB Entry: 1gh2, 2.22 Å

PDB Description: Crystal structure of the catalytic domain of a new human thioredoxin-like protein

PDB Compounds: (A:) thioredoxin-like protein

SCOPe Domain Sequences for d1gh2a_:

Sequence; same for both SEQRES and ATOM records:

>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vgvkpvgsdpdfqpelsgagsrlavvkftmrgcgpclriapafssmsnkypqavflevdv
hqcqgtaatnnisatptfqffrnkvridqyqgadavgleekikqhle

Timeline for d1gh2a_:

• d1gh2a_ first appeared in SCOP 1.57
  
• d1gh2a_ appears in SCOPe 2.05
  
• d1gh2a_ appears in SCOPe 2.07
  
• d1gh2a_ appears in the current release, SCOPe 2.08