Lineage for d1gh0o_ (1gh0 O:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979033Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1979050Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries)
  8. 1979070Domain d1gh0o_: 1gh0 O: [60505]
    Other proteins in same PDB: d1gh0b_, d1gh0d_, d1gh0f_, d1gh0h_, d1gh0j_, d1gh0l_, d1gh0n_, d1gh0p_, d1gh0r_, d1gh0t_, d1gh0v_, d1gh0x_
    complexed with cyc

Details for d1gh0o_

PDB Entry: 1gh0 (more details), 2.2 Å

PDB Description: crystal structure of c-phycocyanin from spirulina platensis
PDB Compounds: (O:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d1gh0o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh0o_ a.1.1.3 (O:) Phycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOPe Domain Coordinates for d1gh0o_:

Click to download the PDB-style file with coordinates for d1gh0o_.
(The format of our PDB-style files is described here.)

Timeline for d1gh0o_: