Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin beta subunit [88940] (9 species) |
Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries) |
Domain d1gh0d_: 1gh0 D: [60494] Other proteins in same PDB: d1gh0a_, d1gh0c_, d1gh0e_, d1gh0g_, d1gh0i_, d1gh0k_, d1gh0m_, d1gh0o_, d1gh0q_, d1gh0s_, d1gh0u_, d1gh0w_ complexed with cyc |
PDB Entry: 1gh0 (more details), 2.2 Å
SCOPe Domain Sequences for d1gh0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh0d_ a.1.1.3 (D:) Phycocyanin beta subunit {Spirulina platensis [TaxId: 118562]} mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs
Timeline for d1gh0d_: