Lineage for d1gd8e_ (1gd8 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238107Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 2238108Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 2238109Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 2238110Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 2238148Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 2238153Domain d1gd8e_: 1gd8 E: [60449]

Details for d1gd8e_

PDB Entry: 1gd8 (more details), 2.3 Å

PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.
PDB Compounds: (E:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1gd8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd8e_ d.188.1.1 (E:) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d1gd8e_:

Click to download the PDB-style file with coordinates for d1gd8e_.
(The format of our PDB-style files is described here.)

Timeline for d1gd8e_: