Class b: All beta proteins [48724] (110 folds) |
Fold b.34: SH3-like barrel [50036] (9 superfamilies) |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (20 proteins) |
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) |
Domain d1gcqa_: 1gcq A: [60434] Other proteins in same PDB: d1gcqc_ |
PDB Entry: 1gcq (more details), 1.68 Å
SCOP Domain Sequences for d1gcqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)} styvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpv
Timeline for d1gcqa_: