SCOP 1.59: Domain d1gcqb_: 1gcq B:

Lineage for d1gcqb_ (1gcq B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (20 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gcqb_: 1gcq B: [60435]
   Other proteins in same PDB: d1gcqc_

Details for d1gcqb_

PDB Entry: 1gcq, 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains

SCOP Domain Sequences for d1gcqb_:

Sequence; same for both SEQRES and ATOM records:

>d1gcqb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

Timeline for d1gcqb_:

• d1gcqb_ first appeared in SCOP 1.57
  
• d1gcqb_ appears in SCOP 1.61
  
• d1gcqb_ appears in the current release, SCOPe 2.08