Lineage for d1g5ce_ (1g5c E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857166Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1857167Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 1857168Protein beta-carbonic anhydrase [53058] (4 species)
  7. 1857178Species Methanobacterium thermoautotrophicum [TaxId:145262] [64084] (1 PDB entry)
  8. 1857183Domain d1g5ce_: 1g5c E: [60268]
    complexed with ca, epe, zn

Details for d1g5ce_

PDB Entry: 1g5c (more details), 2.1 Å

PDB Description: crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum
PDB Compounds: (E:) beta-carbonic anhydrase

SCOPe Domain Sequences for d1g5ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ce_ c.53.2.1 (E:) beta-carbonic anhydrase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikdilrenqdfrfrdlsdlkhspklciitcmdsrlidlleralgigrgdakviknagni
vddgvirsaavaiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidv
lnpvgdeeenviegvkrlkssplipesigvhgliidintgrlkplylde

SCOPe Domain Coordinates for d1g5ce_:

Click to download the PDB-style file with coordinates for d1g5ce_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ce_: