Lineage for d1g12a_ (1g12 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) Protein Fungal zinc peptidase [64336] (2 species) 
Species Grifola frondosa [64337] (4 PDB entries) 
Domain d1g12a_: 1g12 A: [60193]
Details for d1g12a_
PDB Entry: 1g12 (more details), 1.6 Å
PDB Description: zinc peptidase from grifola frondosa
SCOP Domain Sequences for d1g12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g12a_ d.92.1.12 (A:) Fungal zinc peptidase {Grifola frondosa}
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs
SCOP Domain Coordinates for d1g12a_:
Click to download the PDB-style file with coordinates for d1g12a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g12a_:
- d1g12a_ first appeared in SCOP 1.57
- d1g12a_ appears in SCOP 1.61
- d1g12a_ appears in the current release, SCOPe 2.08
View in 3D