Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries) Uniprot P01901 22-299 |
Domain d1fzma1: 1fzm A:182-274 [60152] Other proteins in same PDB: d1fzma2, d1fzmb_ complexed with mpd, mrd, nag, po4; mutant |
PDB Entry: 1fzm (more details), 1.8 Å
SCOPe Domain Sequences for d1fzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzma1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1fzma1: