Lineage for d1fzma1 (1fzm A:182-274)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291728Domain d1fzma1: 1fzm A:182-274 [60152]
    Other proteins in same PDB: d1fzma2, d1fzmb_
    complexed with mpd, mrd, nag, po4; mutant

Details for d1fzma1

PDB Entry: 1fzm (more details), 1.8 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1fzma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzma1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1fzma1:

Click to download the PDB-style file with coordinates for d1fzma1.
(The format of our PDB-style files is described here.)

Timeline for d1fzma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fzma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fzmb_