SCOPe 2.07: Domain d1fzie_: 1fzi E:

Lineage for d1fzie_ (1fzi E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1fzie_: 1fzi E: [60144]
   Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_
   complexed with fe, xe

Details for d1fzie_

PDB Entry: 1fzi, 3.3 Å

PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas

PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOPe Domain Sequences for d1fzie_:

Sequence; same for both SEQRES and ATOM records:

>d1fzie_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

Timeline for d1fzie_:

• d1fzie_ first appeared in SCOP 1.57
  
• d1fzie_ appears in SCOPe 2.06
  
• d1fzie_ appears in the current release, SCOPe 2.08