Lineage for d1fzie_ (1fzi E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46401Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 46421Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 46422Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 46423Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 46424Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 46453Domain d1fzie_: 1fzi E: [60144]
    Other proteins in same PDB: d1fzia_, d1fzib_, d1fzic_, d1fzid_

Details for d1fzie_

PDB Entry: 1fzi (more details), 3.3 Å

PDB Description: methane monooxygenase hydroxylase, form i pressurized with xenon gas

SCOP Domain Sequences for d1fzie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzie_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

SCOP Domain Coordinates for d1fzie_:

Click to download the PDB-style file with coordinates for d1fzie_.
(The format of our PDB-style files is described here.)

Timeline for d1fzie_: