SCOPe 2.01: Domain d1fx7b2: 1fx7 B:65-140

Lineage for d1fx7b2 (1fx7 B:65-140)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
   Uniprot Q50495

8. Domain d1fx7b2: 1fx7 B:65-140 [60092]
   Other proteins in same PDB: d1fx7a1, d1fx7a3, d1fx7b1, d1fx7b3, d1fx7c1, d1fx7c3, d1fx7d1, d1fx7d3
   complexed with co, so4

Details for d1fx7b2

PDB Entry: 1fx7, 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis

PDB Compounds: (B:) iron-dependent repressor ider

SCOPe Domain Sequences for d1fx7b2:

Sequence; same for both SEQRES and ATOM records:

>d1fx7b2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgv

Timeline for d1fx7b2:

• d1fx7b2 first appeared in SCOP 1.57
  
• d1fx7b2 appears in SCOP 1.75
  
• d1fx7b2 appears in SCOPe 2.02
  
• d1fx7b2 appears in the current release, SCOPe 2.08