Lineage for d1fx7b1 (1fx7 B:1-64)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45728Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 45754Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 45755Species Mycobacterium tuberculosis [TaxId:1773] [46886] (2 PDB entries)
  8. 45757Domain d1fx7b1: 1fx7 B:1-64 [60091]
    Other proteins in same PDB: d1fx7a2, d1fx7a3, d1fx7b2, d1fx7b3, d1fx7c2, d1fx7c3, d1fx7d2, d1fx7d3

Details for d1fx7b1

PDB Entry: 1fx7 (more details), 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis

SCOP Domain Sequences for d1fx7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx7b1 a.4.5.24 (B:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

SCOP Domain Coordinates for d1fx7b1:

Click to download the PDB-style file with coordinates for d1fx7b1.
(The format of our PDB-style files is described here.)

Timeline for d1fx7b1: