SCOPe 2.02: Domain d1fthb_: 1fth B:

Lineage for d1fthb_ (1fth B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
   forms trimers with three closely packed beta-sheets similar to the IspF trimers

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries)

8. Domain d1fthb_: 1fth B: [60029]
   complexed with a3p

Details for d1fthb_

PDB Entry: 1fth, 1.9 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (3'5'-adp complex)

PDB Compounds: (B:) acyl carrier protein synthase

SCOPe Domain Sequences for d1fthb_:

Sequence; same for both SEQRES and ATOM records:

>d1fthb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Timeline for d1fthb_:

• d1fthb_ first appeared in SCOP 1.57
  
• d1fthb_ appears in SCOPe 2.01
  
• d1fthb_ appears in SCOPe 2.03
  
• d1fthb_ appears in the current release, SCOPe 2.08