Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) forms trimers with three closely packed beta-sheets similar to the IspF trimers |
Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries) |
Domain d1fthb_: 1fth B: [60029] complexed with a3p |
PDB Entry: 1fth (more details), 1.9 Å
SCOPe Domain Sequences for d1fthb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fthb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee
Timeline for d1fthb_: