Lineage for d1fs0g_ (1fs0 G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855955Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1855956Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 1855957Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 1855981Species Escherichia coli [TaxId:562] [64070] (1 PDB entry)
  8. 1855982Domain d1fs0g_: 1fs0 G: [59999]
    Other proteins in same PDB: d1fs0e1, d1fs0e2
    complexed to the epsilon subunit; the coiled-coil part is disordered

Details for d1fs0g_

PDB Entry: 1fs0 (more details), 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli
PDB Compounds: (G:) ATP synthase gamma subunit

SCOPe Domain Sequences for d1fs0g_:

Sequence, based on SEQRES records: (download)

>d1fs0g_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Escherichia coli [TaxId: 562]}
kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahgnleykhpyledrdvkrvgy
lvvstdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvt
gmgdnpslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpasdddd
lkhkswdylyepdpkalldtllrryvesqvyqgvvenlaseqaarmvamk

Sequence, based on observed residues (ATOM records): (download)

>d1fs0g_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Escherichia coli [TaxId: 562]}
kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahykhpyledrdvkrvgylvvs
tdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvtgmgd
npslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpkhkswdylye
pdpkalldtllrryvesqvyqgvvenlaseqaarmvamk

SCOPe Domain Coordinates for d1fs0g_:

Click to download the PDB-style file with coordinates for d1fs0g_.
(The format of our PDB-style files is described here.)

Timeline for d1fs0g_: