SCOPe 2.02: Domain d1fopb_: 1fop B:

Lineage for d1fopb_ (1fop B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (43 PDB entries)
   Uniprot P29473 67-482

8. Domain d1fopb_: 1fop B: [59937]
   complexed with act, arg, cac, gol, h4b, hem, no, zn

Details for d1fopb_

PDB Entry: 1fop, 2.3 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with l-arg and no(h4b-bound)

PDB Compounds: (B:) Nitric-oxide synthase

SCOPe Domain Sequences for d1fopb_:

Sequence; same for both SEQRES and ATOM records:

>d1fopb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1fopb_:

• d1fopb_ first appeared in SCOP 1.57
  
• d1fopb_ appears in SCOPe 2.01
  
• d1fopb_ appears in SCOPe 2.03
  
• d1fopb_ appears in the current release, SCOPe 2.08