Lineage for d1fg7a_ (1fg7 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1176926Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1177173Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 1177174Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)
  8. 1177175Domain d1fg7a_: 1fg7 A: [59819]
    complexed with pmp

Details for d1fg7a_

PDB Entry: 1fg7 (more details), 1.5 Å

PDB Description: crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate
PDB Compounds: (A:) histidinol phosphate aminotransferase

SCOPe Domain Sequences for d1fg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv

SCOPe Domain Coordinates for d1fg7a_:

Click to download the PDB-style file with coordinates for d1fg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fg7a_: