Lineage for d1f75a_ (1f75 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187408Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 1187409Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 1187410Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
  6. 1187411Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 1187419Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry)
  8. 1187420Domain d1f75a_: 1f75 A: [59662]
    complexed with so4

Details for d1f75a_

PDB Entry: 1f75 (more details), 2.2 Å

PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26
PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d1f75a_:

Sequence, based on SEQRES records: (download)

>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
stenwsrpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakek
tkhntgltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpe
llirtsgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Sequence, based on observed residues (ATOM records): (download)

>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
nylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfa
lnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerls
nfliwqcsysefvfidefwpdfneeslaqcisiyqnr

SCOPe Domain Coordinates for d1f75a_:

Click to download the PDB-style file with coordinates for d1f75a_.
(The format of our PDB-style files is described here.)

Timeline for d1f75a_: