SCOPe 2.05: Domain d1f4la1: 1f4l A:389-548

Lineage for d1f4la1 (1f4l A:389-548)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
   this domain follows the Rossmann-fold catalytic domain of class I aaRS

7. Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)

8. Domain d1f4la1: 1f4l A:389-548 [59648]
   Other proteins in same PDB: d1f4la2, d1f4la3
   protein/RNA complex; complexed with met, zn

Details for d1f4la1

PDB Entry: 1f4l, 1.85 Å

PDB Description: crystal structure of the e.coli methionyl-trna synthetase complexed with methionine

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1f4la1:

Sequence; same for both SEQRES and ATOM records:

>d1f4la1 a.27.1.1 (A:389-548) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaske

Timeline for d1f4la1:

• d1f4la1 first appeared in SCOP 1.57
  
• d1f4la1 appears in SCOPe 2.04
  
• d1f4la1 appears in SCOPe 2.06
  
• d1f4la1 appears in the current release, SCOPe 2.08