Lineage for d1f42a3 (1f42 A:212-306)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767966Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 1767967Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 1767975Domain d1f42a3: 1f42 A:212-306 [59638]
    Other proteins in same PDB: d1f42a1
    complexed with mnb

Details for d1f42a3

PDB Entry: 1f42 (more details), 2.5 Å

PDB Description: the p40 domain of human interleukin-12
PDB Compounds: (A:) interleukin-12 beta chain

SCOPe Domain Sequences for d1f42a3:

Sequence, based on SEQRES records: (download)

>d1f42a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpcs

Sequence, based on observed residues (ATOM records): (download)

>d1f42a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrrvftdktsat
vicrknasisvraqdryyssswsewasvpcs

SCOPe Domain Coordinates for d1f42a3:

Click to download the PDB-style file with coordinates for d1f42a3.
(The format of our PDB-style files is described here.)

Timeline for d1f42a3: