SCOP 1.65: Domain d1f23a_: 1f23 A:

Lineage for d1f23a_ (1f23 A:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (16 PDB entries)

8. Domain d1f23a_: 1f23 A: [59602]

Details for d1f23a_

PDB Entry: 1f23, 2.3 Å

PDB Description: contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function

SCOP Domain Sequences for d1f23a_:

Sequence, based on SEQRES records:

>d1f23a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
ieesqnqqekneqel

Sequence, based on observed residues (ATOM records):

>d1f23a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
sgivqqqnnllraieaqqhllqltvwgtkqlqarlsggrggwmewdreinnytslihsli
eesqnqqekneqel

Timeline for d1f23a_:

• d1f23a_ first appeared in SCOP 1.57
  
• d1f23a_ appears in SCOP 1.63
  
• d1f23a_ appears in SCOP 1.67
  
• d1f23a_ appears in the current release, SCOPe 2.08