Lineage for d1e7pg3 (1e7p G:251-371)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336698Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 336699Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 336700Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 336733Protein Fumarate reductase [56429] (2 species)
  7. 336741Species Wolinella succinogenes [TaxId:844] [56431] (3 PDB entries)
  8. 336748Domain d1e7pg3: 1e7p G:251-371 [59361]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pk1, d1e7pk2, d1e7pl_

Details for d1e7pg3

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7pg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pg3 d.168.1.1 (G:251-371) Fumarate reductase {Wolinella succinogenes}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOP Domain Coordinates for d1e7pg3:

Click to download the PDB-style file with coordinates for d1e7pg3.
(The format of our PDB-style files is described here.)

Timeline for d1e7pg3: