Lineage for d1e7pf_ (1e7p F:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340659Fold f.21: Heme-binding four-helical bundle [81344] (2 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 340685Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 340686Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 340687Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 340688Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries)
  8. 340694Domain d1e7pf_: 1e7p F: [59358]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pk2

Details for d1e7pf_

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOP Domain Coordinates for d1e7pf_:

Click to download the PDB-style file with coordinates for d1e7pf_.
(The format of our PDB-style files is described here.)

Timeline for d1e7pf_: