Lineage for d1e7pb2 (1e7p B:1-106)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018592Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 1018635Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species)
  7. 1018647Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries)
  8. 1018656Domain d1e7pb2: 1e7p B:1-106 [59351]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pl_
    complexed with f3s, fad, fes, hem, lmt, mla, na, sf4

Details for d1e7pb2

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1e7pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pb2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d1e7pb2:

Click to download the PDB-style file with coordinates for d1e7pb2.
(The format of our PDB-style files is described here.)

Timeline for d1e7pb2: