Lineage for d1e6ka_ (1e6k A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586649Protein CheY protein [52174] (5 species)
  7. 1586650Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 1586679Domain d1e6ka_: 1e6k A: [59306]
    mutant

Details for d1e6ka_

PDB Entry: 1e6k (more details), 2 Å

PDB Description: two-component signal transduction system d12a mutant of chey
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1e6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ka_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
mrsdkelkflvvadfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwn
mpnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm

SCOPe Domain Coordinates for d1e6ka_:

Click to download the PDB-style file with coordinates for d1e6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e6ka_: