Lineage for d1e6ka_ (1e6k A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (28 PDB entries) 
Domain d1e6ka_: 1e6k A: [59306]
Details for d1e6ka_
PDB Entry: 1e6k (more details), 2 Å
PDB Description: two-component signal transduction system d12a mutant of chey
SCOP Domain Sequences for d1e6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ka_ c.23.1.1 (A:) CheY protein {Escherichia coli}
mrsdkelkflvvadfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwn
mpnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleek
lnkifeklgm
SCOP Domain Coordinates for d1e6ka_:
Click to download the PDB-style file with coordinates for d1e6ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e6ka_:
- d1e6ka_ is new in SCOP 1.57
- d1e6ka_ appears in SCOP 1.59
- d1e6ka_ appears in the current release, SCOPe 2.08
View in 3D