Lineage for d1e6cb_ (1e6c B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845652Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 1845653Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 1845657Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries)
  8. 1845659Domain d1e6cb_: 1e6c B: [59297]
    complexed with cl, mpd, mrd, po4; mutant

Details for d1e6cb_

PDB Entry: 1e6c (more details), 1.8 Å

PDB Description: k15m mutant of shikimate kinase from erwinia chrysanthemi
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d1e6cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6cb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgmttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaslqahqr
ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrl

SCOPe Domain Coordinates for d1e6cb_:

Click to download the PDB-style file with coordinates for d1e6cb_.
(The format of our PDB-style files is described here.)

Timeline for d1e6cb_: