![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (9 species) |
![]() | Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries) |
![]() | Domain d1e3za1: 1e3z A:394-483 [59213] Other proteins in same PDB: d1e3za2 complexed with aci, ca, na |
PDB Entry: 1e3z (more details), 1.93 Å
SCOPe Domain Sequences for d1e3za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3za1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]} yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit gnrsepvvinsegwgefhvnggsvsiyvqr
Timeline for d1e3za1: