Lineage for d1slma1 (1slm A:16-80)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082515Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 1082516Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 1082525Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 1082542Protein Stromelysin-1 (MMP-3) [63429] (1 species)
  7. 1082543Species Human (Homo sapiens), fibroblast [TaxId:9606] [63431] (1 PDB entry)
  8. 1082544Domain d1slma1: 1slm A:16-80 [59042]
    Other proteins in same PDB: d1slma2
    complexed with ca, zn

Details for d1slma1

PDB Entry: 1slm (more details), 1.9 Å

PDB Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1slma1:

Sequence, based on SEQRES records: (download)

>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
lvqkylenyydlkkdvkqfvrrkdsgpvvkkiremqkflglevtgkldsdtlevmrkprc
gvpdv

Sequence, based on observed residues (ATOM records): (download)

>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
lvqkylenyydlkkdsgpvvkkiremqkflglevtgkldsdtlevmrkprcgvpdv

SCOPe Domain Coordinates for d1slma1:

Click to download the PDB-style file with coordinates for d1slma1.
(The format of our PDB-style files is described here.)

Timeline for d1slma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slma2