Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Thermococcus litoralis [TaxId:2265] [50340] (1 PDB entry) |
Domain d1g2914: 1g29 1:302-372 [58982] Other proteins in same PDB: d1g2912, d1g2922 CASP4 complexed with cl, dio, mg, na, nh4, pop |
PDB Entry: 1g29 (more details), 1.9 Å
SCOPe Domain Sequences for d1g2914:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Thermococcus litoralis [TaxId: 2265]} vrvpgenlvravveivenlgserivrlrvggvtfvgsfrsesrvregvevdvvfdmkkih ifdkttgkaif
Timeline for d1g2914: