Lineage for d1g2912 (1g29 1:1-240)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365100Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1365218Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 1365254Species Thermococcus litoralis [TaxId:2265] [52690] (1 PDB entry)
  8. 1365255Domain d1g2912: 1g29 1:1-240 [32371]
    Other proteins in same PDB: d1g2913, d1g2914, d1g2923, d1g2924
    CASP4
    complexed with cl, dio, mg, na, nh4, pop

Details for d1g2912

PDB Entry: 1g29 (more details), 1.9 Å

PDB Description: malk
PDB Compounds: (1:) maltose transport protein malk

SCOPe Domain Sequences for d1g2912:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi

SCOPe Domain Coordinates for d1g2912:

Click to download the PDB-style file with coordinates for d1g2912.
(The format of our PDB-style files is described here.)

Timeline for d1g2912: