SCOPe 2.01: Domain d1eboc_: 1ebo C:

Lineage for d1eboc_ (1ebo C:)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Core structure of Ebo gp2 [58076] (1 species)

7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)

8. Domain d1eboc_: 1ebo C: [45759]
   chimeric, contains a fragment of gcn4 zipper at the N-terminus (res. 1-29)
   complexed with cl, zn

Details for d1eboc_

PDB Entry: 1ebo, 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

PDB Compounds: (C:) ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2

SCOPe Domain Sequences for d1eboc_:

Sequence; same for both SEQRES and ATOM records:

>d1eboc_ h.3.2.1 (C:) Core structure of Ebo gp2 {Ebola virus [TaxId: 205488]}
qiedkieeilskiyhieneiarikkligeadglieglrqlanettqalqlflrattelrt
fsilnrkaidfllqrwggtchilgpdcriephdwtknitdkidqiihdfvd

Timeline for d1eboc_:

• d1eboc_ first appeared (with stable ids) in SCOP 1.55
  
• d1eboc_ appears in SCOP 1.75
  
• d1eboc_ appears in SCOPe 2.02
  
• d1eboc_ appears in the current release, SCOPe 2.08, called d1eboc1