SCOP 1.63: Domain d1aa0__: 1aa0 -

Lineage for d1aa0__ (1aa0 -)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.17: Fibritin [58046] (1 family)

5. Family h.1.17.1: Fibritin [58047] (1 protein)

6. Protein Fibritin [58048] (1 species)
   biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet

7. Species Bacteriophage T4 [TaxId:10665] [58049] (2 PDB entries)

8. Domain d1aa0__: 1aa0 - [45659]

Details for d1aa0__

PDB Entry: 1aa0, 2.2 Å

PDB Description: fibritin deletion mutant e (bacteriophage t4)

SCOP Domain Sequences for d1aa0__:

Sequence; same for both SEQRES and ATOM records:

>d1aa0__ h.1.17.1 (-) Fibritin {Bacteriophage T4}
vsglnnavqnlqveignnsagikgqvvalntlvngtnpngstveergltnsikanetnia
svtqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstfl

Timeline for d1aa0__:

• d1aa0__ first appeared (with stable ids) in SCOP 1.55
  
• d1aa0__ appears in SCOP 1.61
  
• d1aa0__ appears in SCOP 1.65
  
• d1aa0__ appears in the current release, SCOPe 2.08, called d1aa0a_