Lineage for d1aa0__ (1aa0 -)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. Family h.1.17.1: Fibritin [58047] (1 protein)
  6. Protein Fibritin [58048] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [58049] (2 PDB entries)
  8. Domain d1aa0__: 1aa0 - [45659]

Details for d1aa0__

PDB Entry: 1aa0 (more details), 2.2 Å

PDB Description: fibritin deletion mutant e (bacteriophage t4)

SCOP Domain Sequences for d1aa0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa0__ h.1.17.1 (-) Fibritin {Bacteriophage T4}
vsglnnavqnlqveignnsagikgqvvalntlvngtnpngstveergltnsikanetnia
svtqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstfl

SCOP Domain Coordinates for d1aa0__ are not available.

Timeline for d1aa0__: