Lineage for d1sfca_ (1sfc A:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969135Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 1969136Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 1969149Protein Synaptobrevin [88903] (3 species)
  7. 1969156Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)
  8. 1969159Domain d1sfca_: 1sfc A: [45643]
    Other proteins in same PDB: d1sfcb_, d1sfcc_, d1sfcd_, d1sfcf_, d1sfcg_, d1sfch_, d1sfcj_, d1sfck_, d1sfcl_
    complex with syntaxin and SNAP-25 fragments
    complexed with mpd, sr

Details for d1sfca_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex
PDB Compounds: (A:) protein (synaptobrevin 2)

SCOPe Domain Sequences for d1sfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfca_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
krkywwknl

SCOPe Domain Coordinates for d1sfca_:

Click to download the PDB-style file with coordinates for d1sfca_.
(The format of our PDB-style files is described here.)

Timeline for d1sfca_: