SCOPe 2.05: Domain d1hvvb_: 1hvv B:

Lineage for d1hvvb_ (1hvv B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
   Uniprot P32851 196-259
   a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B

8. Domain d1hvvb_: 1hvv B: [45640]
   Self-association H3 region of syntaxin 1A
   complexed with tar

Details for d1hvvb_

PDB Entry: 1hvv, 2.4 Å

PDB Description: self-association of the h3 region of syntaxin 1a: implications for snare complex assembly

PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1hvvb_:

Sequence; same for both SEQRES and ATOM records:

>d1hvvb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
seietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdtk
ka

Timeline for d1hvvb_:

• d1hvvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hvvb_ appears in SCOPe 2.04
  
• d1hvvb_ appears in SCOPe 2.06
  
• d1hvvb_ appears in the current release, SCOPe 2.08