SCOP 1.61: Domain d1fzbc2: 1fzb C:88-141

Lineage for d1fzbc2 (1fzb C:88-141)

1. Root: SCOP 1.61

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)

8. Domain d1fzbc2: 1fzb C:88-141 [45610]
   Other proteins in same PDB: d1fzbb1, d1fzbc1, d1fzbe1, d1fzbf1

Details for d1fzbc2

PDB Entry: 1fzb, 2.9 Å

PDB Description: crystal structure of crosslinked fragment d

SCOP Domain Sequences for d1fzbc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzbc2 h.1.8.1 (C:88-141) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzbc2:

• d1fzbc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzbc2 appears in SCOP 1.59
  
• d1fzbc2 appears in SCOP 1.63
  
• d1fzbc2 appears in the current release, SCOPe 2.08