Class h: Coiled coil proteins [57942] (5 folds) |
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein) |
Protein Fibrinogen coiled-coil and central regions [58012] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries) |
Domain d1fzbc2: 1fzb C:88-141 [45610] Other proteins in same PDB: d1fzbb1, d1fzbc1, d1fzbe1, d1fzbf1 |
PDB Entry: 1fzb (more details), 2.9 Å
SCOP Domain Sequences for d1fzbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzbc2 h.1.8.1 (C:88-141) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)} kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d1fzbc2: