SCOPe 2.08: Domain d2ztaa_: 2zta A:

Lineage for d2ztaa_ (2zta A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein GCN4 [57961] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
   Uniprot P03069 249-279 ! Uniprot P03069 249-281

8. Domain d2ztaa_: 2zta A: [45474]

Details for d2ztaa_

PDB Entry: 2zta, 1.8 Å

PDB Description: x-ray structure of the gcn4 leucine zipper, a two-stranded, parallel coiled coil

PDB Compounds: (A:) GCN4 leucine zipper

SCOPe Domain Sequences for d2ztaa_:

Sequence; same for both SEQRES and ATOM records:

>d2ztaa_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellsknyhlenevarlkklvg

Timeline for d2ztaa_:

• d2ztaa_ first appeared (with stable ids) in SCOP 1.55
  
• d2ztaa_ appears in SCOPe 2.07