Lineage for d1racd2 (1rac D:101-153)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271476Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 271477Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 271478Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 271479Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)
  8. 271505Domain d1racd2: 1rac D:101-153 [45292]
    Other proteins in same PDB: d1raca1, d1raca2, d1racb1, d1racc1, d1racc2, d1racd1
    complexed with ctp, zn

Details for d1racd2

PDB Entry: 1rac (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1racd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1racd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1racd2:

Click to download the PDB-style file with coordinates for d1racd2.
(The format of our PDB-style files is described here.)

Timeline for d1racd2: