SCOP 1.63: Domain d1racc1: 1rac C:1-150

Lineage for d1racc1 (1rac C:1-150)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudodyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Escherichia coli [TaxId:562] [53674] (29 PDB entries)

8. Domain d1racc1: 1rac C:1-150 [35150]
   Other proteins in same PDB: d1racb1, d1racb2, d1racd1, d1racd2

Details for d1racc1

PDB Entry: 1rac, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1racc1:

Sequence; same for both SEQRES and ATOM records:

>d1racc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1racc1:

• d1racc1 first appeared (with stable ids) in SCOP 1.55
  
• d1racc1 appears in SCOP 1.61
  
• d1racc1 appears in SCOP 1.65
  
• d1racc1 appears in the current release, SCOPe 2.08