Lineage for d1raad2 (1raa D:101-153)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344413Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 344414Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 344415Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 344416Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)
  8. 344438Domain d1raad2: 1raa D:101-153 [45286]
    Other proteins in same PDB: d1raaa1, d1raaa2, d1raab1, d1raac1, d1raac2, d1raad1
    complexed with ctp, zn

Details for d1raad2

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raad2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1raad2:

Click to download the PDB-style file with coordinates for d1raad2.
(The format of our PDB-style files is described here.)

Timeline for d1raad2: