Lineage for d6at1d2 (6at1 D:101-153)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751015Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 751016Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 751017Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 751021Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)
  8. 751045Domain d6at1d2: 6at1 D:101-153 [45276]
    Other proteins in same PDB: d6at1a1, d6at1a2, d6at1b1, d6at1c1, d6at1c2, d6at1d1
    complexed with zn

Details for d6at1d2

PDB Entry: 6at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d6at1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d6at1d2:

Click to download the PDB-style file with coordinates for d6at1d2.
(The format of our PDB-style files is described here.)

Timeline for d6at1d2: