SCOPe 2.08: Domain d6at1d2: 6at1 D:101-153

Lineage for d6at1d2 (6at1 D:101-153)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
   Uniprot P00478

8. Domain d6at1d2: 6at1 D:101-153 [45276]
   Other proteins in same PDB: d6at1a1, d6at1a2, d6at1b1, d6at1c1, d6at1c2, d6at1d1
   complexed with zn

Details for d6at1d2

PDB Entry: 6at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d6at1d2:

Sequence; same for both SEQRES and ATOM records:

>d6at1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d6at1d2:

• d6at1d2 first appeared (with stable ids) in SCOP 1.55
  
• d6at1d2 appears in SCOPe 2.07