SCOP 1.73: Domain d4at1b2: 4at1 B:101-153

Lineage for d4at1b2 (4at1 B:101-153)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)

8. Domain d4at1b2: 4at1 B:101-153 [45271]
   Other proteins in same PDB: d4at1a1, d4at1a2, d4at1b1, d4at1c1, d4at1c2, d4at1d1

Details for d4at1b2

PDB Entry: 4at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d4at1b2:

Sequence; same for both SEQRES and ATOM records:

>d4at1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d4at1b2:

• d4at1b2 first appeared (with stable ids) in SCOP 1.55
  
• d4at1b2 appears in SCOP 1.71
  
• d4at1b2 appears in SCOP 1.75
  
• d4at1b2 appears in the current release, SCOPe 2.08