SCOP 1.73: Domain d4at1c2: 4at1 C:151-310

Lineage for d4at1c2 (4at1 C:151-310)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (45 PDB entries)

8. Domain d4at1c2: 4at1 C:151-310 [35111]
   Other proteins in same PDB: d4at1b1, d4at1b2, d4at1d1, d4at1d2
   complexed with atp, zn

Details for d4at1c2

PDB Entry: 4at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

PDB Compounds: (C:) aspartate carbamoyltransferase (t state), catalytic chain

SCOP Domain Sequences for d4at1c2:

Sequence; same for both SEQRES and ATOM records:

>d4at1c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d4at1c2:

• d4at1c2 first appeared (with stable ids) in SCOP 1.55
  
• d4at1c2 appears in SCOP 1.71
  
• d4at1c2 appears in SCOP 1.75
  
• d4at1c2 appears in the current release, SCOPe 2.08