Lineage for d1d09b2 (1d09 B:101-153)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263404Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2263405Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2263406Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2263407Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2263420Domain d1d09b2: 1d09 B:101-153 [45267]
    Other proteins in same PDB: d1d09a1, d1d09a2, d1d09b1, d1d09c1, d1d09c2, d1d09d1
    complexed with pal, zn

Details for d1d09b2

PDB Entry: 1d09 (more details), 2.1 Å

PDB Description: aspartate transcarbamoylase complexed with n-phosphonacetyl-l-aspartate (pala)
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1d09b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d09b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1d09b2:

Click to download the PDB-style file with coordinates for d1d09b2.
(The format of our PDB-style files is described here.)

Timeline for d1d09b2: