Lineage for d7rxn__ (7rxn -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624740Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 624741Family g.41.5.1: Rubredoxin [57803] (3 proteins)
  6. 624742Protein Rubredoxin [57804] (6 species)
  7. 624791Species Desulfovibrio vulgaris [TaxId:881] [57805] (5 PDB entries)
  8. 624794Domain d7rxn__: 7rxn - [45216]
    complexed with fe, so4

Details for d7rxn__

PDB Entry: 7rxn (more details), 1.5 Å

PDB Description: structure of rubredoxin from desulfovibrio vulgaris at 1.5 a resolution

SCOP Domain Sequences for d7rxn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d7rxn__ g.41.5.1 (-) Rubredoxin {Desulfovibrio vulgaris}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOP Domain Coordinates for d7rxn__:

Click to download the PDB-style file with coordinates for d7rxn__.
(The format of our PDB-style files is described here.)

Timeline for d7rxn__: