Lineage for d7rxna_ (7rxn A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750856Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 750865Protein Rubredoxin [57804] (6 species)
  7. 750915Species Desulfovibrio vulgaris [TaxId:881] [57805] (5 PDB entries)
  8. 750918Domain d7rxna_: 7rxn A: [45216]
    complexed with fe, so4

Details for d7rxna_

PDB Entry: 7rxn (more details), 1.5 Å

PDB Description: structure of rubredoxin from desulfovibrio vulgaris at 1.5 a resolution
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d7rxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOP Domain Coordinates for d7rxna_:

Click to download the PDB-style file with coordinates for d7rxna_.
(The format of our PDB-style files is described here.)

Timeline for d7rxna_: