Lineage for d7rxna_ (7rxn A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036509Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 3036518Protein Rubredoxin [57804] (8 species)
  7. 3036560Species Desulfovibrio vulgaris [TaxId:881] [57805] (8 PDB entries)
  8. 3036563Domain d7rxna_: 7rxn A: [45216]
    complexed with fe, so4

Details for d7rxna_

PDB Entry: 7rxn (more details), 1.5 Å

PDB Description: structure of rubredoxin from desulfovibrio vulgaris at 1.5 a resolution
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d7rxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOPe Domain Coordinates for d7rxna_:

Click to download the PDB-style file with coordinates for d7rxna_.
(The format of our PDB-style files is described here.)

Timeline for d7rxna_: