SCOP 1.65: Domain d1akea2: 1ake A:122-156

Lineage for d1akea2 (1ake A:122-156)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)

7. Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d1akea2: 1ake A:122-156 [45185]
   Other proteins in same PDB: d1akea1, d1akeb1

Details for d1akea2

PDB Entry: 1ake, 1.9 Å

PDB Description: structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state

SCOP Domain Sequences for d1akea2:

Sequence; same for both SEQRES and ATOM records:

>d1akea2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d1akea2:

• d1akea2 first appeared (with stable ids) in SCOP 1.55
  
• d1akea2 appears in SCOP 1.63
  
• d1akea2 appears in SCOP 1.67
  
• d1akea2 appears in the current release, SCOPe 2.08